PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01952.1.g00140.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 710aa    MW: 76404.5 Da    PI: 9.0116
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01952.1.g00140.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.31.9e-09315373563
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   kr +r   NR +A rs +R+  +i+eLe+kv+ L+ae ++L  +l  l+  ++ l +++
  Zpz_sc01952.1.g00140.1.am.mk 315 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQAEATTLSAQLTLLQRDSSGLATQN 373
                                   899******************************************99998887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-16311375IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749313376IPR004827Basic-leucine zipper domain
PfamPF001708.1E-9315373IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-10315372No hitNo description
SuperFamilySSF579593.5E-10315365No hitNo description
CDDcd147032.00E-22316365No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
LNRVERPSER YDHTSTPQRH RHRHRGRIKP SIITQARVAH DRHATVPSSD MNGAANGHGM  60
VHHHLHHHAQ ASAPLPTAFP LPAQHHQQQQ QGAGGGSKQR PGLPPTPPGF HAAHADVCMD  120
DSAARAQALQ GGGLPPRKAH RRSRSDVPFG YLPPPSPKTE AGGGGWCLPG AGGDDLFNAY  180
MTSMEGVDAG GLKYCSDGES RGSSMRTNGA DSSENESEDY GGADSQFLVW GDGAGKKREG  240
VKRNAAGVPA AAPAAGRHTR SLSMDSLMGK LSFSANGEPA GKFSLEFGGG EFTPAEMKRI  300
MADEKLAEMA LADPKRVKRV LANRQSAARS KERRMRYIAE LEQKVQILQA EATTLSAQLT  360
LLQRDSSGLA TQNNELKFRL QAMEQQAQLR DALNEALSAE VQRLKVGDAS SSSNLPQQMQ  420
LRYQSQMHEL HKQQQGEQIP FYQLEQREQN GVARNHDANV RSSEPQRPAC PAVLPTEQGR  480
LRGMVIGAPK FEVSSCCSGP PAQRCAGGNA MLWTGINGKA REKASGGIAG TATEHGFDVA  540
NRVATGERVV LPIHQLMDAP TLAMSVRAPC ATPAWARDRV LFVVEQQRGE RGYRTTLCRP  600
GNRIKICSMP PVKMTSTRSG LLGHHSVLLS AMGFDDELEG EEVESVASKG LTEDCYGDNS  660
CSETTNEDDM RGRRGERQAH QGGQVARGSH MLGERAAKRV AAPASSAGSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352291e-171BT035229.1 Zea mays full-length cDNA clone ZM_BFb0046N14 mRNA, complete cds.
GenBankJX4699261e-171JX469926.1 Zea mays subsp. mays clone UT3184 bZIP-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698006.11e-177PREDICTED: transcription factor RF2b-like
TrEMBLA0A0E0MA281e-175A0A0E0MA28_ORYPU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-65bZIP family protein